SCOPe 2.06: Domain d2zble1: 2zbl E:1-412

Lineage for d2zble1 (2zbl E:1-412)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (2 proteins)
   automatically mapped to Pfam PF07221

6. Protein Putative NAG isomerase YihS [140788] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [140789] (2 PDB entries)
   Uniprot Q8ZKT7 2-413

8. Domain d2zble1: 2zbl E:1-412 [171134]
   Other proteins in same PDB: d2zbla2, d2zblb2, d2zblc2, d2zbld2, d2zble2, d2zblf2
   automated match to d2afaa1
   complexed with bma

Details for d2zble1

PDB Entry: 2zbl, 1.6 Å

PDB Description: functional annotation of salmonella enterica yihs-encoded protein

PDB Compounds: (E:) Putative isomerase

SCOPe Domain Sequences for d2zble1:

Sequence; same for both SEQRES and ATOM records:

>d2zble1 a.102.1.3 (E:1-412) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}
mkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
ayggtpgawiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
wqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldina

Timeline for d2zble1:

• d2zble1 first appeared in SCOPe 2.01, called d2zble_
  
• d2zble1 was called d2zble_ in SCOPe 2.05
  
• d2zble1 appears in SCOPe 2.07
  
• d2zble1 appears in the current release, SCOPe 2.08