![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (3 proteins) automatically mapped to Pfam PF07221 |
![]() | Protein Putative NAG isomerase YihS [140788] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [140789] (2 PDB entries) Uniprot Q8ZKT7 2-413 |
![]() | Domain d2zble1: 2zbl E:1-412 [171134] Other proteins in same PDB: d2zbla2, d2zblb2, d2zblc2, d2zbld2, d2zble2, d2zblf2 automated match to d2afaa1 complexed with bma |
PDB Entry: 2zbl (more details), 1.6 Å
SCOPe Domain Sequences for d2zble1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zble1 a.102.1.3 (E:1-412) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} mkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr ayggtpgawiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw wqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldina
Timeline for d2zble1: