Lineage for d2zaba_ (2zab A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781343Species Sphingomonas sp. [TaxId:90322] [187577] (4 PDB entries)
  8. 2781346Domain d2zaba_: 2zab A: [171127]
    automated match to d1vava_
    complexed with gol

Details for d2zaba_

PDB Entry: 2zab (more details), 1.66 Å

PDB Description: crystal structure of family 7 alginate lyase a1-ii' y284f in cmplex with product (ggg)
PDB Compounds: (A:) Alginate lyase

SCOPe Domain Sequences for d2zaba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zaba_ b.29.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
aaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggttan
ssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtnap
plvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdtr
svdfvgkdagwknlkyyfkagnfvqdntstggsaiaklyslsvshs

SCOPe Domain Coordinates for d2zaba_:

Click to download the PDB-style file with coordinates for d2zaba_.
(The format of our PDB-style files is described here.)

Timeline for d2zaba_: