Lineage for d2zaaa_ (2zaa A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782141Species Sphingomonas sp. [TaxId:90322] [187577] (4 PDB entries)
  8. 1782145Domain d2zaaa_: 2zaa A: [171126]
    automated match to d1vava_
    complexed with gol

Details for d2zaaa_

PDB Entry: 2zaa (more details), 1.8 Å

PDB Description: Crystal Structure of Family 7 Alginate Lyase A1-II' H191N/Y284F in Complex with Substrate (GGMG)
PDB Compounds: (A:) Alginate lyase

SCOPe Domain Sequences for d2zaaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zaaa_ b.29.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
paaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtta
nssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqingimddgtna
pplvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdt
rsvdfvgkdagwknlkyyfkagnfvqdntstggsaiaklyslsvshsnlehh

SCOPe Domain Coordinates for d2zaaa_:

Click to download the PDB-style file with coordinates for d2zaaa_.
(The format of our PDB-style files is described here.)

Timeline for d2zaaa_: