![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Sphingomonas sp. [TaxId:90322] [187577] (4 PDB entries) |
![]() | Domain d2zaaa1: 2zaa A:81-308 [171126] Other proteins in same PDB: d2zaaa2 automated match to d1vava_ complexed with gol |
PDB Entry: 2zaa (more details), 1.8 Å
SCOPe Domain Sequences for d2zaaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zaaa1 b.29.1.0 (A:81-308) automated matches {Sphingomonas sp. [TaxId: 90322]} paaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtta nssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqingimddgtna pplvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdt rsvdfvgkdagwknlkyyfkagnfvqdntstggsaiaklyslsvshsn
Timeline for d2zaaa1: