Lineage for d2zaaa1 (2zaa A:81-308)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781343Species Sphingomonas sp. [TaxId:90322] [187577] (4 PDB entries)
  8. 2781347Domain d2zaaa1: 2zaa A:81-308 [171126]
    Other proteins in same PDB: d2zaaa2
    automated match to d1vava_
    complexed with gol

Details for d2zaaa1

PDB Entry: 2zaa (more details), 1.8 Å

PDB Description: crystal structure of family 7 alginate lyase a1-ii' h191n/y284f in complex with substrate (ggmg)
PDB Compounds: (A:) Alginate lyase

SCOPe Domain Sequences for d2zaaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zaaa1 b.29.1.0 (A:81-308) automated matches {Sphingomonas sp. [TaxId: 90322]}
paaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtta
nssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqingimddgtna
pplvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdt
rsvdfvgkdagwknlkyyfkagnfvqdntstggsaiaklyslsvshsn

SCOPe Domain Coordinates for d2zaaa1:

Click to download the PDB-style file with coordinates for d2zaaa1.
(The format of our PDB-style files is described here.)

Timeline for d2zaaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zaaa2