Lineage for d2za9a_ (2za9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781340Species Sphingomonas sp. [188455] (2 PDB entries)
  8. 2781342Domain d2za9a_: 2za9 A: [171125]
    automated match to d1vava_
    complexed with so4

Details for d2za9a_

PDB Entry: 2za9 (more details), 2.1 Å

PDB Description: crystal structure of alginate lyase a1-ii' n141c/n199c
PDB Compounds: (A:) Alginate lyase

SCOPe Domain Sequences for d2za9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2za9a_ b.29.1.0 (A:) automated matches {Sphingomonas sp.}
paaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtta
cssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtca
pplvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdt
rsvdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshs

SCOPe Domain Coordinates for d2za9a_:

Click to download the PDB-style file with coordinates for d2za9a_.
(The format of our PDB-style files is described here.)

Timeline for d2za9a_: