Lineage for d2za4d_ (2za4 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851515Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
    automatically mapped to Pfam PF01337
  5. 2851516Family c.9.1.1: Barstar-related [52039] (3 proteins)
  6. 2851555Protein automated matches [190697] (2 species)
    not a true protein
  7. 2851556Species Bacillus amyloliquefaciens [TaxId:1390] [188456] (6 PDB entries)
  8. 2851560Domain d2za4d_: 2za4 D: [171124]
    Other proteins in same PDB: d2za4a_, d2za4c_
    automated match to d1b27d_
    complexed with cl

Details for d2za4d_

PDB Entry: 2za4 (more details), 1.58 Å

PDB Description: crystal structural analysis of barnase-barstar complex
PDB Compounds: (D:) barstar

SCOPe Domain Sequences for d2za4d_:

Sequence, based on SEQRES records: (download)

>d2za4d_ c.9.1.1 (D:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
mkkavingeqirsisdlhqtlkkelalpeyygenldalwaaltgwveyplvlewrqfeqs
kqltengaesvlqvfreakaegaditiils

Sequence, based on observed residues (ATOM records): (download)

>d2za4d_ c.9.1.1 (D:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
mkkavingeqirsisdlhqtlkkelalpeyygenldalwaaltgwveyplvlewrqfqln
gaesvlqvfreakaegaditiils

SCOPe Domain Coordinates for d2za4d_:

Click to download the PDB-style file with coordinates for d2za4d_.
(The format of our PDB-style files is described here.)

Timeline for d2za4d_: