Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.1: Barstar-related [52038] (1 family) automatically mapped to Pfam PF01337 |
Family c.9.1.1: Barstar-related [52039] (3 proteins) |
Protein automated matches [190697] (2 species) not a true protein |
Species Bacillus amyloliquefaciens [TaxId:1390] [188456] (6 PDB entries) |
Domain d2za4d_: 2za4 D: [171124] Other proteins in same PDB: d2za4a_, d2za4c_ automated match to d1b27d_ complexed with cl |
PDB Entry: 2za4 (more details), 1.58 Å
SCOPe Domain Sequences for d2za4d_:
Sequence, based on SEQRES records: (download)
>d2za4d_ c.9.1.1 (D:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]} mkkavingeqirsisdlhqtlkkelalpeyygenldalwaaltgwveyplvlewrqfeqs kqltengaesvlqvfreakaegaditiils
>d2za4d_ c.9.1.1 (D:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]} mkkavingeqirsisdlhqtlkkelalpeyygenldalwaaltgwveyplvlewrqfqln gaesvlqvfreakaegaditiils
Timeline for d2za4d_: