SCOPe 2.03: Domain d2z90d_: 2z90 D:

Lineage for d2z90d_ (2z90 D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (19 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [188322] (6 PDB entries)

8. Domain d2z90d_: 2z90 D: [171113]
   automated match to d1o9ra_
   complexed with cl, fe2, mg

Details for d2z90d_

PDB Entry: 2z90, 2.4 Å

PDB Description: Crystal Structure of the Second Dps from Mycobacterium smegmatis

PDB Compounds: (D:) Starvation-inducible DNA-binding protein or fine tangled pili major subunit

SCOPe Domain Sequences for d2z90d_:

Sequence; same for both SEQRES and ATOM records:

>d2z90d_ a.25.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
tirrvhdavdaedpstadllhglidglekqawlirsenrkv

Timeline for d2z90d_:

• d2z90d_ first appeared in SCOPe 2.01
  
• d2z90d_ appears in SCOPe 2.02
  
• d2z90d_ appears in SCOPe 2.04
  
• d2z90d_ appears in the current release, SCOPe 2.08