![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (9 PDB entries) |
![]() | Domain d2z8wd1: 2z8w D:1-113 [171109] Other proteins in same PDB: d2z8wc2, d2z8wd2 automated match to d1vesa_ |
PDB Entry: 2z8w (more details), 2.45 Å
SCOPe Domain Sequences for d2z8wd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8wd1 b.1.1.1 (D:1-113) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn kgsksfslrisdlrvedsgtykcqafyslllrdynysllfrgekgagtaltvk
Timeline for d2z8wd1: