Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (5 PDB entries) |
Domain d2z8wc_: 2z8w C: [171108] automated match to d1vesa_ |
PDB Entry: 2z8w (more details), 2.45 Å
SCOPe Domain Sequences for d2z8wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8wc_ b.1.1.1 (C:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn kgsksfslrisdlrvedsgtykcqafyslllrdynysllfrgekgagtaltvkaaa
Timeline for d2z8wc_: