Lineage for d2z8wc_ (2z8w C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513455Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (5 PDB entries)
  8. 1513460Domain d2z8wc_: 2z8w C: [171108]
    automated match to d1vesa_

Details for d2z8wc_

PDB Entry: 2z8w (more details), 2.45 Å

PDB Description: structure of an ignar-ama1 complex
PDB Compounds: (C:) new antigen receptor variable domain

SCOPe Domain Sequences for d2z8wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z8wc_ b.1.1.1 (C:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
kgsksfslrisdlrvedsgtykcqafyslllrdynysllfrgekgagtaltvkaaa

SCOPe Domain Coordinates for d2z8wc_:

Click to download the PDB-style file with coordinates for d2z8wc_.
(The format of our PDB-style files is described here.)

Timeline for d2z8wc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2z8wd_