SCOPe 2.08: Domain d2z8wc1: 2z8w C:1-113

Lineage for d2z8wc1 (2z8w C:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (9 PDB entries)

8. Domain d2z8wc1: 2z8w C:1-113 [171108]
   Other proteins in same PDB: d2z8wc2, d2z8wd2
   automated match to d1vesa_

Details for d2z8wc1

PDB Entry: 2z8w, 2.45 Å

PDB Description: structure of an ignar-ama1 complex

PDB Compounds: (C:) new antigen receptor variable domain

SCOPe Domain Sequences for d2z8wc1:

Sequence; same for both SEQRES and ATOM records:

>d2z8wc1 b.1.1.1 (C:1-113) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
kgsksfslrisdlrvedsgtykcqafyslllrdynysllfrgekgagtaltvk

Timeline for d2z8wc1:

• d2z8wc1 first appeared in SCOPe 2.01, called d2z8wc_
  
• d2z8wc1 appears in SCOPe 2.07