Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) |
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins) contains only one 4Fe-4S cluster |
Protein automated matches [190107] (2 species) not a true protein |
Species Pyrococcus furiosus [TaxId:186497] [188173] (1 PDB entry) |
Domain d2z8qa_: 2z8q A: [171105] automated match to d1siza_ complexed with nco, sf4 |
PDB Entry: 2z8q (more details), 1.7 Å
SCOPe Domain Sequences for d2z8qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8qa_ d.58.1.4 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]} awkvsvdqdtcigcaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa itieea
Timeline for d2z8qa_: