SCOPe 2.08: Domain d2z8ab_: 2z8a B:

Lineage for d2z8ab_ (2z8a B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)

8. Domain d2z8ab_: 2z8a B: [171103]
   automated match to d1nxfa_
   complexed with cmo, hem, po4, xe

Details for d2z8ab_

PDB Entry: 2z8a, 1.06 Å

PDB Description: ligand migration and binding in the dimeric hemoglobin of scapharca inaequivalvis: i25w with co bound to heme and in the presence of 3 atoms of xe

PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d2z8ab_:

Sequence; same for both SEQRES and ATOM records:

>d2z8ab_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
psvydaaaqltadvkkdlrdswkvwgsdkkgngvalmttlfadnqetigyfkrlgdvsqg
mandklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikk
vlasknfgdkyanawaklvavvqaal

Timeline for d2z8ab_:

• d2z8ab_ first appeared in SCOPe 2.01
  
• d2z8ab_ appears in SCOPe 2.07