SCOPe 2.06: Domain d2z85b_: 2z85 B:

Lineage for d2z85b_ (2z85 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (37 PDB entries)

8. Domain d2z85b_: 2z85 B: [171101]
   automated match to d1nxfa_
   complexed with hem

Details for d2z85b_

PDB Entry: 2z85, 1.6 Å

PDB Description: ligand migration and binding in the dimeric hemoglobin of scapharca inaequivalvis: m37f unliganded

PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d2z85b_:

Sequence; same for both SEQRES and ATOM records:

>d2z85b_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalfttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d2z85b_:

• d2z85b_ first appeared in SCOPe 2.01
  
• d2z85b_ appears in SCOPe 2.05
  
• d2z85b_ appears in SCOPe 2.07
  
• d2z85b_ appears in the current release, SCOPe 2.08