SCOPe 2.06: Domain d2z7cd_: 2z7c D:

Lineage for d2z7cd_ (2z7c D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (3 families)

5. Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)

6. Protein automated matches [190221] (4 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [188523] (1 PDB entry)

8. Domain d2z7cd_: 2z7c D: [171099]
   automated match to d1nfja_
   complexed with arg

Details for d2z7cd_

PDB Entry: 2z7c, 2.8 Å

PDB Description: crystal structure of chromatin protein alba from hyperthermophilic archaeon pyrococcus horikoshii

PDB Compounds: (D:) DNA/RNA-binding protein Alba

SCOPe Domain Sequences for d2z7cd_:

Sequence; same for both SEQRES and ATOM records:

>d2z7cd_ d.68.6.1 (D:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
teehvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddvd
vkeikigteelptadgrttntstieivlarkt

Timeline for d2z7cd_:

• d2z7cd_ first appeared in SCOPe 2.01
  
• d2z7cd_ appears in SCOPe 2.05
  
• d2z7cd_ appears in SCOPe 2.07
  
• d2z7cd_ appears in the current release, SCOPe 2.08