![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.6: AlbA-like [82704] (3 families) ![]() |
![]() | Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) |
![]() | Protein automated matches [190221] (2 species) not a true protein |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [188523] (1 PDB entry) |
![]() | Domain d2z7cb_: 2z7c B: [171097] automated match to d1nfja_ complexed with arg |
PDB Entry: 2z7c (more details), 2.8 Å
SCOPe Domain Sequences for d2z7cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z7cb_ d.68.6.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} hvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddvdvke ikigteelptadgrttntstieivlarkt
Timeline for d2z7cb_: