Lineage for d2z7ca_ (2z7c A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563801Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2564158Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2564159Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2564178Protein automated matches [190221] (4 species)
    not a true protein
  7. 2564182Species Pyrococcus horikoshii [TaxId:53953] [188523] (1 PDB entry)
  8. 2564183Domain d2z7ca_: 2z7c A: [171096]
    automated match to d1nfja_
    complexed with arg

Details for d2z7ca_

PDB Entry: 2z7c (more details), 2.8 Å

PDB Description: crystal structure of chromatin protein alba from hyperthermophilic archaeon pyrococcus horikoshii
PDB Compounds: (A:) DNA/RNA-binding protein Alba

SCOPe Domain Sequences for d2z7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z7ca_ d.68.6.1 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
hvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddvdvke
ikigteelptadgrttntstieivlarkt

SCOPe Domain Coordinates for d2z7ca_:

Click to download the PDB-style file with coordinates for d2z7ca_.
(The format of our PDB-style files is described here.)

Timeline for d2z7ca_: