Lineage for d2z6pa_ (2z6p A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508127Family d.20.1.4: UFC1-like [143072] (2 protein domains)
    automatically mapped to Pfam PF08694
  6. 2508128Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species)
    aka cgi-126
  7. 2508129Species Human (Homo sapiens) [TaxId:9606] [143074] (7 PDB entries)
    Uniprot Q9Y3C8 1-167
  8. 2508131Domain d2z6pa_: 2z6p A: [171085]
    automated match to d1ywza1

Details for d2z6pa_

PDB Entry: 2z6p (more details), 1.8 Å

PDB Description: Crystal Structure of the Ufc1, Ufm1 conjugating enzyme 1
PDB Compounds: (A:) Ufm1-conjugating enzyme 1

SCOPe Domain Sequences for d2z6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z6pa_ d.20.1.4 (A:) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}
madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhke

SCOPe Domain Coordinates for d2z6pa_:

Click to download the PDB-style file with coordinates for d2z6pa_.
(The format of our PDB-style files is described here.)

Timeline for d2z6pa_: