| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.4: UFC1-like [143072] (2 proteins) automatically mapped to Pfam PF08694 |
| Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species) aka cgi-126 |
| Species Human (Homo sapiens) [TaxId:9606] [143074] (7 PDB entries) Uniprot Q9Y3C8 1-167 |
| Domain d2z6oa_: 2z6o A: [171084] automated match to d1ywza1 complexed with mg |
PDB Entry: 2z6o (more details), 1.6 Å
SCOPe Domain Sequences for d2z6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z6oa_ d.20.1.4 (A:) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}
madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcn
Timeline for d2z6oa_: