Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2z6mh_ (2z6m H:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein automated matches [190041] (18 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187027] (11 PDB entries)
  8. Domain d2z6mh_: 2z6m H: [171079]
    automated match to d1fhaa_
    complexed with ca, mpd, zn

Details for d2z6mh_

PDB Entry: 2z6m (more details)
PDB Description: crystal structure of human ferritin h8 as biotemplate for noble metal nanoparticle synthesis
PDB Compounds: (H:) ferritin heavy chain

SCOP Domain Sequences for d2z6mh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z6mh_ a.25.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg

SCOP Domain Coordinates for d2z6mh_:

Click to download the PDB-style file with coordinates for d2z6mh_.
(The format of our PDB-style files is described here.)

Timeline for d2z6mh_:

d2z6mh_ appears in SCOP 1.75A


d2z6mh_
(click for larger image)


d2z6mh_ in context of chain



d2z6mh_ in context of PDB
Domains from other chains:
d2z6ma_, d2z6mb_, d2z6mc_, d2z6md_, d2z6me_, d2z6mf_, d2z6mg_, d2z6mi_, d2z6mj_, d2z6mk_, d2z6ml_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu