Lineage for d2z6md_ (2z6m D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702543Species Human (Homo sapiens) [TaxId:9606] [187027] (13 PDB entries)
  8. 2702555Domain d2z6md_: 2z6m D: [171075]
    automated match to d1fhaa_
    complexed with ca, mpd, zn

Details for d2z6md_

PDB Entry: 2z6m (more details), 2.72 Å

PDB Description: crystal structure of human ferritin h8 as biotemplate for noble metal nanoparticle synthesis
PDB Compounds: (D:) ferritin heavy chain

SCOPe Domain Sequences for d2z6md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z6md_ a.25.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d2z6md_:

Click to download the PDB-style file with coordinates for d2z6md_.
(The format of our PDB-style files is described here.)

Timeline for d2z6md_: