Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187027] (13 PDB entries) |
Domain d2z6md_: 2z6m D: [171075] automated match to d1fhaa_ complexed with ca, mpd, zn |
PDB Entry: 2z6m (more details), 2.72 Å
SCOPe Domain Sequences for d2z6md_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z6md_ a.25.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
Timeline for d2z6md_: