Lineage for d1efab1 (1efa B:2-60)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442266Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 442267Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families) (S)
  5. 442379Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (3 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 442384Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 442385Species Escherichia coli [TaxId:562] [47442] (9 PDB entries)
  8. 442387Domain d1efab1: 1efa B:2-60 [17107]
    Other proteins in same PDB: d1efaa2, d1efab2, d1efac2

Details for d1efab1

PDB Entry: 1efa (more details), 2.6 Å

PDB Description: crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf

SCOP Domain Sequences for d1efab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efab1 a.35.1.5 (B:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli}
kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

SCOP Domain Coordinates for d1efab1:

Click to download the PDB-style file with coordinates for d1efab1.
(The format of our PDB-style files is described here.)

Timeline for d1efab1: