Lineage for d2z61a_ (2z61 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1000625Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1000626Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1001696Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1001697Protein automated matches [190151] (25 species)
    not a true protein
  7. 1001777Species Methanococcus jannaschii [TaxId:2190] [188462] (1 PDB entry)
  8. 1001778Domain d2z61a_: 2z61 A: [171066]
    automated match to d1o4sb_

Details for d2z61a_

PDB Entry: 2z61 (more details), 2.2 Å

PDB Description: Crystal structure of MJ0684 from Methanococcus jannaschii reveals its similarity in the active site to kynurenine aminotransferases
PDB Compounds: (A:) Probable aspartate aminotransferase 2

SCOPe Domain Sequences for d2z61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z61a_ c.67.1.0 (A:) automated matches {Methanococcus jannaschii [TaxId: 2190]}
mlskrllnfesfevmdilalaqklesegkkvihleigepdfntpkpivdegikslkegkt
hytdsrgilelrekiselykdkykadiipdniiitggsslglffalssiiddgdevliqn
pcypcyknfirflgakpvfcdftvesleealsdktkaiiinspsnplgevidreiyefay
enipyiisdeiynglvyegkcysaiefdenlektilingfsklyamtgwrigyvisndei
ieailklqqnlfisaptisqyaalkafeketereinsmikefdrrrrlvlkyvkdfgwev
nnpigayyvfpnigedgrefaykllkekfvaltpgigfgskgknyirisyansyenikeg
lerikefln

SCOPe Domain Coordinates for d2z61a_:

Click to download the PDB-style file with coordinates for d2z61a_.
(The format of our PDB-style files is described here.)

Timeline for d2z61a_: