Lineage for d2z5fa_ (2z5f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866454Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2866537Protein Thyroid hormone sulfotransferase Sult1b1 [117530] (1 species)
  7. 2866538Species Human (Homo sapiens) [TaxId:9606] [117531] (2 PDB entries)
    Uniprot O43704
  8. 2866541Domain d2z5fa_: 2z5f A: [171060]
    automated match to d1xv1a_
    complexed with a3p

Details for d2z5fa_

PDB Entry: 2z5f (more details), 2.1 Å

PDB Description: Human sulfotransferase Sult1b1 in complex with PAP
PDB Compounds: (A:) Sulfotransferase family cytosolic 1B member 1

SCOPe Domain Sequences for d2z5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z5fa_ c.37.1.5 (A:) Thyroid hormone sulfotransferase Sult1b1 {Human (Homo sapiens) [TaxId: 9606]}
pkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidmiln
dgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfwenn
ckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknwwkr
keehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvnyth
lpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei

SCOPe Domain Coordinates for d2z5fa_:

Click to download the PDB-style file with coordinates for d2z5fa_.
(The format of our PDB-style files is described here.)

Timeline for d2z5fa_: