Lineage for d1efaa1 (1efa A:2-60)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152229Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 152230Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 152326Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 152331Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 152332Species Escherichia coli [TaxId:562] [47442] (8 PDB entries)
  8. 152333Domain d1efaa1: 1efa A:2-60 [17106]
    Other proteins in same PDB: d1efaa2, d1efab2, d1efac2

Details for d1efaa1

PDB Entry: 1efa (more details), 2.6 Å

PDB Description: crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf

SCOP Domain Sequences for d1efaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli}
kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

SCOP Domain Coordinates for d1efaa1:

Click to download the PDB-style file with coordinates for d1efaa1.
(The format of our PDB-style files is described here.)

Timeline for d1efaa1: