SCOPe 2.03: Domain d2z5db_: 2z5d B:

Lineage for d2z5db_ (2z5d B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (1 PDB entry)
   Uniprot P62256 4-155

8. Domain d2z5db_: 2z5d B: [171059]
   automated match to d2z5da1
   complexed with na

Details for d2z5db_

PDB Entry: 2z5d, 2.1 Å

PDB Description: human ubiquitin-conjugating enzyme e2 h

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 H

SCOPe Domain Sequences for d2z5db_:

Sequence; same for both SEQRES and ATOM records:

>d2z5db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]}
pgkrrmdtdviklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypfks
psigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidplngd
aaamylhrpeeykqkikeyiqkyateealke

Timeline for d2z5db_:

• d2z5db_ first appeared in SCOPe 2.01, called d2z5db1
  
• d2z5db_ was called d2z5db1 in SCOPe 2.02
  
• d2z5db_ appears in SCOPe 2.04
  
• d2z5db_ appears in the current release, SCOPe 2.08