| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
| Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (2 PDB entries) Uniprot P62256 4-155 |
| Domain d2z5db_: 2z5d B: [171059] automated match to d2z5da1 complexed with na |
PDB Entry: 2z5d (more details), 2.1 Å
SCOPe Domain Sequences for d2z5db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z5db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]}
pgkrrmdtdviklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypfks
psigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidplngd
aaamylhrpeeykqkikeyiqkyateealke
Timeline for d2z5db_: