SCOPe 2.05: Domain d2z5da1: 2z5d A:23-174

Lineage for d2z5da1 (2z5d A:23-174)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (1 PDB entry)
   Uniprot P62256 4-155

8. Domain d2z5da1: 2z5d A:23-174 [171058]
   complexed with na

Details for d2z5da1

PDB Entry: 2z5d, 2.1 Å

PDB Description: human ubiquitin-conjugating enzyme e2 h

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 H

SCOPe Domain Sequences for d2z5da1:

Sequence; same for both SEQRES and ATOM records:

>d2z5da1 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]}
pspgkrrmdtdviklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypf
kspsigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidpln
gdaaamylhrpeeykqkikeyiqkyateealk

Timeline for d2z5da1:

• d2z5da1 first appeared in SCOPe 2.01
  
• d2z5da1 appears in SCOPe 2.04
  
• d2z5da1 appears in SCOPe 2.06
  
• d2z5da1 appears in the current release, SCOPe 2.08