Lineage for d2z5da1 (2z5d A:23-174)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1406998Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (1 PDB entry)
    Uniprot P62256 4-155
  8. 1406999Domain d2z5da1: 2z5d A:23-174 [171058]
    complexed with na

Details for d2z5da1

PDB Entry: 2z5d (more details), 2.1 Å

PDB Description: human ubiquitin-conjugating enzyme e2 h
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 H

SCOPe Domain Sequences for d2z5da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z5da1 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]}
pspgkrrmdtdviklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypf
kspsigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidpln
gdaaamylhrpeeykqkikeyiqkyateealk

SCOPe Domain Coordinates for d2z5da1:

Click to download the PDB-style file with coordinates for d2z5da1.
(The format of our PDB-style files is described here.)

Timeline for d2z5da1: