| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
| Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (1 PDB entry) Uniprot P62256 4-155 |
| Domain d2z5da1: 2z5d A:23-174 [171058] complexed with na |
PDB Entry: 2z5d (more details), 2.1 Å
SCOPe Domain Sequences for d2z5da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z5da1 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]}
pspgkrrmdtdviklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypf
kspsigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidpln
gdaaamylhrpeeykqkikeyiqkyateealk
Timeline for d2z5da1: