SCOP 1.73: Domain d1prva_: 1prv A:

Lineage for d1prva_ (1prv A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)

7. Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)

8. Domain d1prva_: 1prv A: [17105]

Details for d1prva_

PDB Entry: 1prv

PDB Description: purine repressor dna-binding domain dna binding

PDB Compounds: (A:) purine repressor

SCOP Domain Sequences for d1prva_:

Sequence; same for both SEQRES and ATOM records:

>d1prva_ a.35.1.5 (A:) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]}
matikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkv

Timeline for d1prva_:

• d1prva_ first appeared (with stable ids) in SCOP 1.55, called d1prv__
  
• d1prva_ was called d1prv__ in SCOP 1.71
  
• d1prva_ appears in SCOP 1.75
  
• d1prva_ appears in the current release, SCOPe 2.08