Lineage for d2z42a1 (2z42 A:81-308)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781340Species Sphingomonas sp. [188455] (2 PDB entries)
  8. 2781341Domain d2z42a1: 2z42 A:81-308 [171047]
    Other proteins in same PDB: d2z42a2
    automated match to d1vava_
    complexed with so4

Details for d2z42a1

PDB Entry: 2z42 (more details), 1.6 Å

PDB Description: crystal structure of family 7 alginate lyase a1-ii' from sphingomonas sp. a1
PDB Compounds: (A:) Alginate lyase

SCOPe Domain Sequences for d2z42a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z42a1 b.29.1.0 (A:81-308) automated matches {Sphingomonas sp.}
paaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtta
nssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtna
pplvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdt
rsvdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshsn

SCOPe Domain Coordinates for d2z42a1:

Click to download the PDB-style file with coordinates for d2z42a1.
(The format of our PDB-style files is described here.)

Timeline for d2z42a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z42a2