Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.6: LFTR-like [143711] (2 proteins) Pfam PF03588; closer relative to the nonribosomal peptidyltransferases (82749); deletion of the N-terminal half of the N-terminal NAT-like domain after the domain duplication/swapping events |
Protein Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) [143712] (1 species) |
Species Escherichia coli [TaxId:562] [143713] (7 PDB entries) Uniprot P0A8P1 1-232 |
Domain d2z3pb_: 2z3p B: [171046] automated match to d2cxaa1 complexed with leu, tar |
PDB Entry: 2z3p (more details), 2.5 Å
SCOPe Domain Sequences for d2z3pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3pb_ d.108.1.6 (B:) Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) {Escherichia coli [TaxId: 562]} rlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwsp dpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayh rlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighg gklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfsp
Timeline for d2z3pb_: