Lineage for d2z3pb_ (2z3p B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209690Family d.108.1.6: LFTR-like [143711] (2 proteins)
    Pfam PF03588; closer relative to the nonribosomal peptidyltransferases (82749); deletion of the N-terminal half of the N-terminal NAT-like domain after the domain duplication/swapping events
  6. 2209691Protein Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) [143712] (1 species)
  7. 2209692Species Escherichia coli [TaxId:562] [143713] (7 PDB entries)
    Uniprot P0A8P1 1-232
  8. 2209699Domain d2z3pb_: 2z3p B: [171046]
    automated match to d2cxaa1
    complexed with leu, tar

Details for d2z3pb_

PDB Entry: 2z3p (more details), 2.5 Å

PDB Description: complex structure of LF-transferase and leucine
PDB Compounds: (B:) Leucyl/phenylalanyl-tRNA-protein transferase

SCOPe Domain Sequences for d2z3pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3pb_ d.108.1.6 (B:) Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) {Escherichia coli [TaxId: 562]}
rlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwsp
dpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayh
rlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighg
gklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfsp

SCOPe Domain Coordinates for d2z3pb_:

Click to download the PDB-style file with coordinates for d2z3pb_.
(The format of our PDB-style files is described here.)

Timeline for d2z3pb_: