SCOPe 2.07: Domain d2z3ob_: 2z3o B:

Lineage for d2z3ob_ (2z3o B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.6: LFTR-like [143711] (2 proteins)
   Pfam PF03588; closer relative to the nonribosomal peptidyltransferases (82749); deletion of the N-terminal half of the N-terminal NAT-like domain after the domain duplication/swapping events

6. Protein Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) [143712] (1 species)

7. Species Escherichia coli [TaxId:562] [143713] (7 PDB entries)
   Uniprot P0A8P1 1-232

8. Domain d2z3ob_: 2z3o B: [171044]
   automated match to d2cxaa1
   complexed with phe, tar

Details for d2z3ob_

PDB Entry: 2z3o, 2.4 Å

PDB Description: complex structure of LF-transferase and phenylalanine

PDB Compounds: (B:) Leucyl/phenylalanyl-tRNA-protein transferase

SCOPe Domain Sequences for d2z3ob_:

Sequence; same for both SEQRES and ATOM records:

>d2z3ob_ d.108.1.6 (B:) Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) {Escherichia coli [TaxId: 562]}
rlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwsp
dpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayh
rlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighg
gklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfsp

Timeline for d2z3ob_:

• d2z3ob_ first appeared in SCOPe 2.01
  
• d2z3ob_ appears in SCOPe 2.06
  
• d2z3ob_ appears in the current release, SCOPe 2.08