Lineage for d2z3oa_ (2z3o A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575512Family d.108.1.6: LFTR-like [143711] (2 proteins)
    Pfam PF03588; closer relative to the nonribosomal peptidyltransferases (82749); deletion of the N-terminal half of the N-terminal NAT-like domain after the domain duplication/swapping events
  6. 2575513Protein Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) [143712] (1 species)
  7. 2575514Species Escherichia coli [TaxId:562] [143713] (7 PDB entries)
    Uniprot P0A8P1 1-232
  8. 2575518Domain d2z3oa_: 2z3o A: [171043]
    automated match to d2cxaa1
    complexed with phe, tar

Details for d2z3oa_

PDB Entry: 2z3o (more details), 2.4 Å

PDB Description: complex structure of LF-transferase and phenylalanine
PDB Compounds: (A:) Leucyl/phenylalanyl-tRNA-protein transferase

SCOPe Domain Sequences for d2z3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3oa_ d.108.1.6 (A:) Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) {Escherichia coli [TaxId: 562]}
rlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwsp
dpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayh
rlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighg
gklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfspq

SCOPe Domain Coordinates for d2z3oa_:

Click to download the PDB-style file with coordinates for d2z3oa_.
(The format of our PDB-style files is described here.)

Timeline for d2z3oa_: