Lineage for d1pru__ (1pru -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537367Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 537398Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 537399Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 537422Domain d1pru__: 1pru - [17104]

Details for d1pru__

PDB Entry: 1pru (more details)

PDB Description: purine repressor dna-binding domain dna binding

SCOP Domain Sequences for d1pru__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pru__ a.35.1.5 (-) Purine repressor (PurR), N-terminal domain {Escherichia coli}
matikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkv

SCOP Domain Coordinates for d1pru__:

Click to download the PDB-style file with coordinates for d1pru__.
(The format of our PDB-style files is described here.)

Timeline for d1pru__: