Lineage for d1qp7a1 (1qp7 A:3-58)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) 
Family a.35.1.5: Bacterial repressors [47438] (3 proteins) Protein Purine repressor (PurR), N-terminal domain [47439] (1 species) Species Escherichia coli [TaxId:562] [47440] (21 PDB entries) 
Domain d1qp7a1: 1qp7 A:3-58 [17103]
Other proteins in same PDB: d1qp7a2
Details for d1qp7a1
PDB Entry: 1qp7 (more details), 2.9 Å
PDB Description: purine repressor mutant-hypoxanthine-palindromic operator complex
SCOP Domain Sequences for d1qp7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qp7a1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslavnh
SCOP Domain Coordinates for d1qp7a1:
Click to download the PDB-style file with coordinates for d1qp7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qp7a1:
View in 3D
