Lineage for d2z36b1 (2z36 B:9-407)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005764Species Nonomuraea recticatena [TaxId:46178] [188167] (1 PDB entry)
  8. 2005766Domain d2z36b1: 2z36 B:9-407 [171019]
    Other proteins in same PDB: d2z36a2, d2z36b2
    automated match to d1cl6a_
    complexed with fe, hem, mes

Details for d2z36b1

PDB Entry: 2z36 (more details), 2.8 Å

PDB Description: Crystal structure of cytochrome P450 MoxA from Nonomuraea recticatena (CYP105)
PDB Compounds: (B:) Cytochrome P450 type compactin 3'',4''-hydroxylase

SCOPe Domain Sequences for d2z36b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z36b1 a.104.1.0 (B:9-407) automated matches {Nonomuraea recticatena [TaxId: 46178]}
laglelpvergcpfappaayerlrerapinkvrltsggqawwvsgheearavladgrfss
dkrkdgfplftldaatlqqlrsqpplmlgmdgaehsaarrpvigeftvkrlaalrpriqd
ivdhfiddmlatdqrpvdlvqalslpvpslvicellgvpytdhdffqsrttmmvsrtsme
drrrafaelrayiddlitrkesepgddlfsrqiarqrqegtldhaglvslafllltaghe
ttanmislgvvgllshpeqltvvkanpgrtpmaveellryftiadgvtsrlatedveigg
vsikagegvivsmlsanwdpavfkdpavldvergarhhlafgfgphqclgqnlarmelqi
vfdtlfrripslrlavpmedvpfkgdsviygvhelpvtw

SCOPe Domain Coordinates for d2z36b1:

Click to download the PDB-style file with coordinates for d2z36b1.
(The format of our PDB-style files is described here.)

Timeline for d2z36b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z36b2