| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (11 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries) |
| Domain d2z35a_: 2z35 A: [171016] automated match to d1ac6a_ |
PDB Entry: 2z35 (more details), 2.2 Å
SCOPe Domain Sequences for d2z35a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z35a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsvtqtggqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featynkeatsfhlqkasvqesdsavyycalsenygnekitfgagtkltikp
Timeline for d2z35a_: