Lineage for d2z2eb_ (2z2e B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1013457Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1014110Protein automated matches [190299] (4 species)
    not a true protein
  7. 1014111Species Canis lupus [TaxId:9615] [188283] (1 PDB entry)
  8. 1014113Domain d2z2eb_: 2z2e B: [171014]
    automated match to d1el1a_
    complexed with so4

Details for d2z2eb_

PDB Entry: 2z2e (more details), 2.01 Å

PDB Description: Crystal Structure of Canine Milk Lysozyme Stabilized against Non-enzymatic Deamidation
PDB Compounds: (B:) Lysozyme C, milk isozyme

SCOPe Domain Sequences for d2z2eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z2eb_ d.2.1.2 (B:) automated matches {Canis lupus [TaxId: 9615]}
kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafqgrqsqgssdygifqln
skwwcksqshssanacnimcskflddnidddiacakrvvkdpqgmsawvawvkhckgkdl
skylascnl

SCOPe Domain Coordinates for d2z2eb_:

Click to download the PDB-style file with coordinates for d2z2eb_.
(The format of our PDB-style files is described here.)

Timeline for d2z2eb_: