Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) |
Protein automated matches [190299] (4 species) not a true protein |
Species Canis lupus [TaxId:9615] [188283] (1 PDB entry) |
Domain d2z2eb_: 2z2e B: [171014] automated match to d1el1a_ complexed with so4 |
PDB Entry: 2z2e (more details), 2.01 Å
SCOPe Domain Sequences for d2z2eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z2eb_ d.2.1.2 (B:) automated matches {Canis lupus [TaxId: 9615]} kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafqgrqsqgssdygifqln skwwcksqshssanacnimcskflddnidddiacakrvvkdpqgmsawvawvkhckgkdl skylascnl
Timeline for d2z2eb_: