SCOPe 2.08: Domain d2z2ea_: 2z2e A:

Lineage for d2z2ea_ (2z2e A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (8 species)
   not a true protein

7. Species Dog (Canis familiaris) [TaxId:9615] [188283] (1 PDB entry)

8. Domain d2z2ea_: 2z2e A: [171013]
   automated match to d1el1a_
   complexed with so4

Details for d2z2ea_

PDB Entry: 2z2e, 2.01 Å

PDB Description: crystal structure of canine milk lysozyme stabilized against non- enzymatic deamidation

PDB Compounds: (A:) Lysozyme C, milk isozyme

SCOPe Domain Sequences for d2z2ea_:

Sequence; same for both SEQRES and ATOM records:

>d2z2ea_ d.2.1.2 (A:) automated matches {Dog (Canis familiaris) [TaxId: 9615]}
kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafqgrqsqgssdygifqln
skwwcksqshssanacnimcskflddnidddiacakrvvkdpqgmsawvawvkhckgkdl
skylascnl

Timeline for d2z2ea_:

• d2z2ea_ first appeared in SCOPe 2.01
  
• d2z2ea_ appears in SCOPe 2.07