Lineage for d2z23a_ (2z23 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145363Species Yersinia pestis [TaxId:214092] [188272] (2 PDB entries)
  8. 2145366Domain d2z23a_: 2z23 A: [170993]
    automated match to d1b05a_

Details for d2z23a_

PDB Entry: 2z23 (more details), 2 Å

PDB Description: Crystal structure of Y.pestis oligo peptide binding protein OppA with tri-lysine ligand
PDB Compounds: (A:) periplasmic oligopeptide-binding protein

SCOPe Domain Sequences for d2z23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z23a_ c.94.1.1 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
anvptgvqlaekqvlvrnngsepqsldphkiegvpesnisrdlleglvindpngnivpga
aeswdnkdfkvwtfnirkdakwsngdpvtaqdfvyswqrladpktvspyasylqyahltn
iddiitgkaapdtlgvkalddhtlevtlsepvpyldkllahplmspvnktvvekfgekwt
qpqnfvgngayklkdwivnerivlersptywdnaktvinqvtylpissevtdvnryrsge
idmtynnmpielfqklkkeipdqvhvdpylctyyyeinnqkapftdarvrealklgmdrd
iivnkvknqgdlpaygftppytsgaeltppewfswtqekrnevakkllaeagytkdnplk
fsllyntsdlhkklaiaaasiwkknlgvdvklenqewktfldtrhqgtydvaraawcady
nepssflnmmlsnssnntthykssvfdkliedtlkvksekeradlyqqaeiqldkdsaiv
pvfyyvsarlvkpyvggytgkdpldnmhvkdlyiikq

SCOPe Domain Coordinates for d2z23a_:

Click to download the PDB-style file with coordinates for d2z23a_.
(The format of our PDB-style files is described here.)

Timeline for d2z23a_: