![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.89: Cyanovirin-N [51321] (1 superfamily) complex fold |
![]() | Superfamily b.89.1: Cyanovirin-N [51322] (2 families) ![]() duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins automatically mapped to Pfam PF08881 |
![]() | Family b.89.1.1: Cyanovirin-N [51323] (2 proteins) |
![]() | Protein automated matches [190774] (1 species) not a true protein |
![]() | Species Nostoc ellipsosporum [TaxId:45916] [188001] (9 PDB entries) |
![]() | Domain d2z21a1: 2z21 A:1-101 [170989] Other proteins in same PDB: d2z21a2, d2z21b2 automated match to d1iiya_ |
PDB Entry: 2z21 (more details), 1.8 Å
SCOPe Domain Sequences for d2z21a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z21a1 b.89.1.1 (A:1-101) automated matches {Nostoc ellipsosporum [TaxId: 45916]} lgnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrn tqlagsselaaecktraqqfvstkinlddhiaaidgtlkye
Timeline for d2z21a1: