Lineage for d2z1sa_ (2z1s A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084062Species Paenibacillus polymyxa [TaxId:1406] [187337] (5 PDB entries)
  8. 2084067Domain d2z1sa_: 2z1s A: [170985]
    automated match to d1uyqa1
    complexed with ctt

Details for d2z1sa_

PDB Entry: 2z1s (more details), 2.46 Å

PDB Description: beta-glucosidase b from paenibacillus polymyxa complexed with cellotetraose
PDB Compounds: (A:) Beta-glucosidase B

SCOPe Domain Sequences for d2z1sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z1sa_ c.1.8.0 (A:) automated matches {Paenibacillus polymyxa [TaxId: 1406]}
ntfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgdvacdhfhhf
kedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielaglipmltlyhw
dlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasilgygtgehap
ghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserpedvaaairr
dgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflginyytrsii
rstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpilitengaamrd
elvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgyskrfgivhi
nyetqertpkqsalwfkqmmakngf

SCOPe Domain Coordinates for d2z1sa_:

Click to download the PDB-style file with coordinates for d2z1sa_.
(The format of our PDB-style files is described here.)

Timeline for d2z1sa_: