SCOPe 2.06: Domain d2z1ob_: 2z1o B:

Lineage for d2z1ob_ (2z1o B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (21 species)
   not a true protein

7. Species Echinophyllia sp. [TaxId:301887] [188534] (16 PDB entries)

8. Domain d2z1ob_: 2z1o B: [170982]
   automated match to d1mova_

Details for d2z1ob_

PDB Entry: 2z1o, 1.75 Å

PDB Description: Crystal structure of a photoswitchable GFP-like protein Dronpa in the bright-state

PDB Compounds: (B:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2z1ob_:

Sequence; same for both SEQRES and ATOM records:

>d2z1ob_ d.22.1.0 (B:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs

Timeline for d2z1ob_:

• d2z1ob_ first appeared in SCOPe 2.01
  
• d2z1ob_ appears in SCOPe 2.05
  
• d2z1ob_ appears in SCOPe 2.07
  
• d2z1ob_ appears in the current release, SCOPe 2.08