SCOPe 2.06: Domain d2z1ma_: 2z1m A:

Lineage for d2z1ma_ (2z1m A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (51 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188271] (2 PDB entries)

8. Domain d2z1ma_: 2z1m A: [170975]
   automated match to d1t2aa_
   complexed with gdp, ndp

Details for d2z1ma_

PDB Entry: 2z1m, 2 Å

PDB Description: Crystal Structure of GDP-D-Mannose Dehydratase from Aquifex aeolicus VF5

PDB Compounds: (A:) GDP-D-mannose dehydratase

SCOPe Domain Sequences for d2z1ma_:

Sequence; same for both SEQRES and ATOM records:

>d2z1ma_ c.2.1.2 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
gkralitgirgqdgaylaklllekgyevygadrrsgefaswrlkelgiendvkiihmdll
efsniirtiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdtkf
yqastsemfgkvqeipqtektpfyprspyavaklfghwitvnyreaynmfacsgilfnhe
splrgiefvtrkityslarikyglqdklvlgnlnakrdwgyapeyveamwlmmqqpepdd
yviatgethtvrefvekaakiagfdiewvgeginekgidrntgkvivevseeffrpaevd
ilvgnpekamkklgwkprttfdelveimmeadlkrvrd

Timeline for d2z1ma_:

• d2z1ma_ first appeared in SCOPe 2.01
  
• d2z1ma_ appears in SCOPe 2.05
  
• d2z1ma_ appears in SCOPe 2.07
  
• d2z1ma_ appears in the current release, SCOPe 2.08