SCOPe 2.08: Domain d2z1ib_: 2z1i B:

Lineage for d2z1ib_ (2z1i B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein automated matches [190266] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188270] (5 PDB entries)

8. Domain d2z1ib_: 2z1i B: [170973]
   automated match to d1rbva_
   mutant

Details for d2z1ib_

PDB Entry: 2z1i, 2 Å

PDB Description: crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k)

PDB Compounds: (B:) ribonuclease hi

SCOPe Domain Sequences for d2z1ib_:

Sequence; same for both SEQRES and ATOM records:

>d2z1ib_ c.55.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
mlkrveiftdgsclgnpgpggygailryrgrektfsagyerttnnrmelmaaivalealk
ehcevilstdshyvrkgitewihnwkkrgwkkadkkpvknvdlwkrldaalgrhkikwew
vkghaghpenercdelaraaamnptledtgy

Timeline for d2z1ib_:

• d2z1ib_ first appeared in SCOPe 2.01
  
• d2z1ib_ appears in SCOPe 2.07