Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein automated matches [190266] (7 species) not a true protein |
Species Escherichia coli [TaxId:562] [188270] (4 PDB entries) |
Domain d2z1ga_: 2z1g A: [170970] automated match to d1rbua_ mutant |
PDB Entry: 2z1g (more details), 2.1 Å
SCOPe Domain Sequences for d2z1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z1ga_ c.55.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]} mlkrveiftdgsclgnpgpggygailryrgrektfsagyerttnnrmelmaaivalealk ehcevilstdshyvrkgitewihnwkkrgwkkadkkpvknvdlwkrldaalgqhqikwew vkghaghpenercdelaraaamnptledtgyqvev
Timeline for d2z1ga_: