SCOPe 2.05: Domain d2z1ga_: 2z1g A:

Lineage for d2z1ga_ (2z1g A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein automated matches [190266] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188270] (4 PDB entries)

8. Domain d2z1ga_: 2z1g A: [170970]
   automated match to d1rbua_
   mutant

Details for d2z1ga_

PDB Entry: 2z1g, 2.1 Å

PDB Description: crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k)

PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d2z1ga_:

Sequence; same for both SEQRES and ATOM records:

>d2z1ga_ c.55.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mlkrveiftdgsclgnpgpggygailryrgrektfsagyerttnnrmelmaaivalealk
ehcevilstdshyvrkgitewihnwkkrgwkkadkkpvknvdlwkrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

Timeline for d2z1ga_:

• d2z1ga_ first appeared in SCOPe 2.01
  
• d2z1ga_ appears in SCOPe 2.04
  
• d2z1ga_ appears in SCOPe 2.06
  
• d2z1ga_ appears in the current release, SCOPe 2.08