Lineage for d2z1ga_ (2z1g A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2886080Protein automated matches [190266] (7 species)
    not a true protein
  7. 2886087Species Escherichia coli [TaxId:562] [188270] (5 PDB entries)
  8. 2886090Domain d2z1ga_: 2z1g A: [170970]
    automated match to d1rbua_
    mutant

Details for d2z1ga_

PDB Entry: 2z1g (more details), 2.1 Å

PDB Description: crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k)
PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d2z1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z1ga_ c.55.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mlkrveiftdgsclgnpgpggygailryrgrektfsagyerttnnrmelmaaivalealk
ehcevilstdshyvrkgitewihnwkkrgwkkadkkpvknvdlwkrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

SCOPe Domain Coordinates for d2z1ga_:

Click to download the PDB-style file with coordinates for d2z1ga_.
(The format of our PDB-style files is described here.)

Timeline for d2z1ga_: