| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
| Protein Purine repressor (PurR), N-terminal domain [47439] (1 species) |
| Species Escherichia coli [TaxId:562] [47440] (24 PDB entries) |
| Domain d1qpza1: 1qpz A:2-58 [17097] Other proteins in same PDB: d1qpza2 protein/DNA complex; complexed with hpa |
PDB Entry: 1qpz (more details), 2.5 Å
SCOPe Domain Sequences for d1qpza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]}
atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh
Timeline for d1qpza1: